CXCL12蛋白；SDF-1蛋白;Stromal Cell-Derived Factor 1; SDF-1; hSDF-1; C-X-C Motif Chemokine 12; Intercrine Reduced in Hepatomas; IRH; hIRH; Pre-B Cell Growth-Stimulating Factor; PBSF; CXCL12; SDF1; SDF1A; SDF1B

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKA LNK

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1α and SDF1β are identical except for the four residues present in the C-terminus of SDF1β but absent from SDF1α. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface, and can also bind syndecan4. SDF1 is known to influence lymphopoiesis, regulate patterning and cell number of neural progenitors, and promote angiogenesis. It also enhances the survival of myeloid progenitor cells.

P48061