Recombinant Mouse Interferon alpha-2 is produced by our E.coli expression system and the target gene encoding Cys24-Glu190 is expressed.

Interferon α-2蛋白;Interferon Alpha-2; IFN-Alpha-2; Interferon Alpha-A; LeIF A; IFNA2

Mouse

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM PB,100mM Nacl,pH7.5.

MCDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQIQKAQAIPVLRDLTQT LNLFTSKASSAAWNATLLDSFCNDLHQLNDLQTCLMQVGVQEPPLTQEDALLAVRKYFHRITV YLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

At least 23 different variants of Interferon-α are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-α subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-α subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.

P01573