Interleukin-1β蛋白；IL-1β蛋白;Interleukin-1 beta; Catabolin; IL1F2; IL1B.

Human

Escherichia coli.

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5.

MAPVRSLNCTLRDSQKSLVMSGPYELKALHLQGQDMEQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAEN MPVFLGGTKGGQDITDFTMQFVSS

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Measured by its ability to induce NF-kB signaling in 293-IL1 Res cells. The ED50 for this effect is 20-100 pg/ml.Purity: Greater than 95% as determined by reducing SDS-PAGE. Less than 0.1 ng/ug (1 EU/ug) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells.

P01584